C11ORF46 (ARL14EP) (NM_152316) Human Mass Spec Standard

SKU
PH308413
C11orf46 MS Standard C13 and N15-labeled recombinant protein (NP_689529)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208413]
Predicted MW 29.3 kDa
Protein Sequence
Protein Sequence
>RC208413 protein sequence
Red=Cloning site Green=Tags(s)

MMDPCSVGVQLRTTNECHKTYYTRHTGFKTLQELSSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFED
LQKSCCDPFNIHKKLAKKNLHVIDLDDATFLSAKFGRQLVPGWKLCPKCTQIINGSVDVDTEDRQKRKPE
SDGRTAKALRSLQFTNPGRQTEFAPETGKREKRRLTKNATAGSDRQVIPAKSKVYDSQGLLIFSGMDLCD
CLDEDCLGCFYACPACGSTKCGAECRCDRKWLYEQIEIEGGEIIHNKHAG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689529
RefSeq Size 2395
RefSeq ORF 780
Synonyms ARF7EP; C11orf46; dJ299F11.1
Locus ID 120534
UniProt ID Q8N8R7
Cytogenetics 11p14.1
Summary The protein encoded by this gene is an effector protein. It interacts with ADP-ribosylation factor-like 14 [ARL14, also known as ADP-ribosylation factor 7 (ARF7)], beta-actin (ACTB) and actin-based motor protein myosin 1E (MYO1E). ARL14 is a small GTPase; it controls the export of major histocompatibility class II molecules by connecting to the actin network via this effector protein. [provided by RefSeq, Sep 2014]
Write Your Own Review
You're reviewing:C11ORF46 (ARL14EP) (NM_152316) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407642 ARL14EP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407642 Transient overexpression lysate of chromosome 11 open reading frame 46 (C11orf46) 100 ug
$436.00
TP308413 Recombinant protein of human chromosome 11 open reading frame 46 (C11orf46), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.