C11ORF46 (ARL14EP) (NM_152316) Human Tagged ORF Clone

SKU
RC208413
ARL14EP (Myc-DDK-tagged)-Human chromosome 11 open reading frame 46 (C11orf46)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol C11ORF46
Synonyms ARF7EP; C11orf46; dJ299F11.1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208413 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGGATCCATGTTCAGTTGGAGTCCAGCTTCGTACTACAAATGAGTGCCATAAAACCTACTATACTC
GTCACACAGGTTTTAAGACTTTGCAAGAATTGTCATCAAATGATATGCTTTTACTTCAACTTAGAACTGG
AATGACACTTTCTGGGAACAATACAATTTGCTTTCATCATGTAAAAATTTACATTGACAGATTTGAGGAT
TTACAGAAGTCATGTTGTGACCCATTTAACATACACAAGAAATTAGCCAAAAAAAATTTGCATGTAATTG
ACTTAGATGATGCCACTTTTCTGAGTGCTAAATTTGGAAGACAGCTTGTACCTGGTTGGAAGCTTTGTCC
AAAATGCACACAGATAATCAATGGAAGTGTGGATGTTGATACTGAAGACCGCCAGAAAAGGAAACCTGAG
TCAGATGGAAGAACTGCTAAAGCTTTGAGGTCATTACAATTTACGAATCCAGGAAGGCAAACTGAATTTG
CTCCAGAAACTGGTAAAAGAGAAAAAAGAAGGCTTACAAAAAATGCAACCGCTGGTTCAGACAGACAAGT
GATACCAGCAAAGAGTAAGGTCTATGATAGCCAGGGTCTCCTGATTTTTAGTGGGATGGACCTCTGTGAC
TGCCTGGATGAAGACTGCTTAGGATGTTTCTATGCTTGTCCTGCCTGTGGTTCTACCAAGTGTGGAGCTG
AATGCCGCTGTGACCGCAAGTGGCTGTATGAGCAAATTGAAATTGAAGGAGGAGAAATAATTCATAATAA
ACATGCTGGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208413 protein sequence
Red=Cloning site Green=Tags(s)

MMDPCSVGVQLRTTNECHKTYYTRHTGFKTLQELSSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFED
LQKSCCDPFNIHKKLAKKNLHVIDLDDATFLSAKFGRQLVPGWKLCPKCTQIINGSVDVDTEDRQKRKPE
SDGRTAKALRSLQFTNPGRQTEFAPETGKREKRRLTKNATAGSDRQVIPAKSKVYDSQGLLIFSGMDLCD
CLDEDCLGCFYACPACGSTKCGAECRCDRKWLYEQIEIEGGEIIHNKHAG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_152316
ORF Size 780 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_152316.3
RefSeq Size 2395 bp
RefSeq ORF 783 bp
Locus ID 120534
UniProt ID Q8N8R7
Cytogenetics 11p14.1
MW 29.3 kDa
Summary The protein encoded by this gene is an effector protein. It interacts with ADP-ribosylation factor-like 14 [ARL14, also known as ADP-ribosylation factor 7 (ARF7)], beta-actin (ACTB) and actin-based motor protein myosin 1E (MYO1E). ARL14 is a small GTPase; it controls the export of major histocompatibility class II molecules by connecting to the actin network via this effector protein. [provided by RefSeq, Sep 2014]
Write Your Own Review
You're reviewing:C11ORF46 (ARL14EP) (NM_152316) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208413L3 Lenti ORF clone of Human chromosome 11 open reading frame 46 (C11orf46), Myc-DDK-tagged 10 ug
$600.00
RC208413L4 Lenti ORF clone of Human chromosome 11 open reading frame 46 (C11orf46), mGFP tagged 10 ug
$600.00
RG208413 ARL14EP (tGFP-tagged) - Human chromosome 11 open reading frame 46 (C11orf46) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC100823 ARL14EP (untagged)-Human chromosome 11 open reading frame 46 (C11orf46) 10 ug
$300.00
SC324326 ARL14EP (untagged)-Human chromosome 11 open reading frame 46 (C11orf46) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.