QPCT (NM_012413) Human Mass Spec Standard

SKU
PH308388
QPCT MS Standard C13 and N15-labeled recombinant protein (NP_036545)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208388]
Predicted MW 40.9 kDa
Protein Sequence
Protein Sequence
>RC208388 protein sequence
Red=Cloning site Green=Tags(s)

MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDL
QPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACH
YDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQ
DSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHE
LGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKI
LQVFVLEYLHL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036545
RefSeq Size 1719
RefSeq ORF 1083
Synonyms GCT; QC; sQC
Locus ID 25797
UniProt ID Q16769
Cytogenetics 2p22.2
Summary This gene encodes human pituitary glutaminyl cyclase, which is responsible for the presence of pyroglutamyl residues in many neuroendocrine peptides. The amino acid sequence of this enzyme is 86% identical to that of bovine glutaminyl cyclase. [provided by RefSeq, Jul 2008]
Protein Families Protease
Write Your Own Review
You're reviewing:QPCT (NM_012413) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415772 QPCT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415772 Transient overexpression lysate of glutaminyl-peptide cyclotransferase (QPCT) 100 ug
$436.00
TP308388 Recombinant protein of human glutaminyl-peptide cyclotransferase (QPCT), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.