QPCT Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-QPCT antibody: synthetic peptide directed towards the middle region of human QPCT. Synthetic peptide located within the following region: SRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSA |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 38 kDa |
Gene Name | glutaminyl-peptide cyclotransferase |
Database Link | |
Background | This gene encodes human pituitary glutaminyl cyclase, which is responsible for the presence of pyroglutamyl residues in many neuroendocrine peptides. The amino acid sequence of this enzyme is 86% identical to that of bovine glutaminyl cyclase. [provided by RefSeq, Jul 2008] |
Synonyms | GCT; QC; sQC |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Sheep: 86%; Bovine: 86%; Dog: 79%; Horse: 79%; Mouse: 79% |
Reference Data | |
Protein Families | Protease |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.