NAA40 (NM_024771) Human Mass Spec Standard

SKU
PH308314
NAA40 MS Standard C13 and N15-labeled recombinant protein (NP_079047)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208314]
Predicted MW 27.2 kDa
Protein Sequence
Protein Sequence
>RC208314 protein sequence
Red=Cloning site Green=Tags(s)

MGRKSSKAKEKKQKRLEERAAMDAVCAKVDAANRLGDPLEAFPVFKKYDRNGLNVSIECKRVSGLEPATV
DWAFDLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEV
QLESKVRRKGLGKFLIQILQLMANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDDSSPSMSGCCGEDCS
YEILSRRTKFGDSHHSHAGGHCGGCCH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079047
RefSeq Size 3681
RefSeq ORF 711
Synonyms hNatD; NAT11; NatD; PATT1
Locus ID 79829
UniProt ID Q86UY6
Cytogenetics 11q13.1
Summary N-alpha-acetyltransferase that specifically mediates the acetylation of the N-terminal residues of histones H4 and H2A (PubMed:21935442, PubMed:25619998). In contrast to other N-alpha-acetyltransferase, has a very specific selectivity for histones H4 and H2A N-terminus and specifically recognizes the 'Ser-Gly-Arg-Gly sequence' (PubMed:21935442, PubMed:25619998). Acts as a negative regulator of apoptosis (PubMed:26666750). May play a role in hepatic lipid metabolism (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:NAA40 (NM_024771) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411083 NAA40 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411083 Transient overexpression lysate of N(alpha)-acetyltransferase 40, NatD catalytic subunit, homolog (S. cerevisiae) (NAA40) 100 ug
$436.00
TP308314 Recombinant protein of human N-acetyltransferase 11 (GCN5-related, putative) (NAT11), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.