NAA40 (NM_024771) Human Tagged ORF Clone

SKU
RC208314
NAA40 (Myc-DDK-tagged)-Human N(alpha)-acetyltransferase 40, NatD catalytic subunit, homolog (S. cerevisiae) (NAA40)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NAA40
Synonyms hNatD; NAT11; NatD; PATT1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208314 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAGAAAGTCAAGCAAAGCCAAGGAGAAGAAGCAGAAGCGGTTGGAGGAGCGAGCAGCCATGGATG
CCGTTTGTGCCAAAGTGGACGCTGCCAACAGGCTTGGAGACCCTCTGGAGGCTTTCCCAGTGTTCAAGAA
ATATGATAGAAACGGGTTGAATGTCTCCATTGAATGTAAGCGAGTGTCTGGACTGGAGCCAGCCACCGTG
GATTGGGCCTTCGACCTGACCAAAACGAATATGCAAACCATGTATGAGCAGAGCGAGTGGGGCTGGAAGG
ACCGAGAGAAACGGGAGGAAATGACAGATGACCGAGCCTGGTACCTCATCGCGTGGGAAAACAGCTCCGT
CCCTGTTGCCTTTTCTCACTTCCGGTTTGACGTGGAGTGTGGGGATGAAGTCCTGTACTGCTATGAAGTG
CAGTTGGAAAGCAAGGTGCGGCGGAAAGGCCTGGGGAAGTTCCTCATACAGATCCTGCAGCTCATGGCCA
ACAGCACACAGATGAAGAAGGTTATGTTAACAGTATTTAAACACAATCATGGTGCCTACCAGTTCTTCAG
AGAAGCGTTGCAATTTGAAATTGATGACTCTTCCCCCAGCATGTCCGGTTGCTGTGGGGAGGATTGCTCC
TATGAGATCCTGAGCCGGAGGACCAAGTTTGGGGACAGCCATCACTCCCACGCGGGTGGGCACTGTGGTG
GCTGCTGCCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208314 protein sequence
Red=Cloning site Green=Tags(s)

MGRKSSKAKEKKQKRLEERAAMDAVCAKVDAANRLGDPLEAFPVFKKYDRNGLNVSIECKRVSGLEPATV
DWAFDLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEV
QLESKVRRKGLGKFLIQILQLMANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDDSSPSMSGCCGEDCS
YEILSRRTKFGDSHHSHAGGHCGGCCH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_024771
ORF Size 711 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024771.4
RefSeq Size 3681 bp
RefSeq ORF 714 bp
Locus ID 79829
UniProt ID Q86UY6
Cytogenetics 11q13.1
Domains Acetyltransf
MW 27.2 kDa
Summary N-alpha-acetyltransferase that specifically mediates the acetylation of the N-terminal residues of histones H4 and H2A (PubMed:21935442, PubMed:25619998). In contrast to other N-alpha-acetyltransferase, has a very specific selectivity for histones H4 and H2A N-terminus and specifically recognizes the 'Ser-Gly-Arg-Gly sequence' (PubMed:21935442, PubMed:25619998). Acts as a negative regulator of apoptosis (PubMed:26666750). May play a role in hepatic lipid metabolism (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:NAA40 (NM_024771) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208314L3 Lenti ORF clone of Human N(alpha)-acetyltransferase 40, NatD catalytic subunit, homolog (S. cerevisiae) (NAA40), Myc-DDK-tagged 10 ug
$600.00
RC208314L4 Lenti ORF clone of Human N(alpha)-acetyltransferase 40, NatD catalytic subunit, homolog (S. cerevisiae) (NAA40), mGFP tagged 10 ug
$600.00
RG208314 NAA40 (tGFP-tagged) - Human N(alpha)-acetyltransferase 40, NatD catalytic subunit, homolog (S. cerevisiae) (NAA40) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC112052 NAA40 (untagged)-Human N(alpha)-acetyltransferase 40, NatD catalytic subunit, homolog (S. cerevisiae) (NAA40) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.