RAB4B (NM_016154) Human Mass Spec Standard

SKU
PH308302
RAB4B MS Standard C13 and N15-labeled recombinant protein (NP_057238)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208302]
Predicted MW 23.6 kDa
Protein Sequence
Protein Sequence
>RC208302 protein sequence
Red=Cloning site Green=Tags(s)

MAETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQERF
RSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCGNKKDLDPEREVTFLEASRFA
QENELMFLETSALTGENVEEAFLKCARTILNKIDSGELDPERMGSGIQYGDASLRQLRQPRSAQAVAPQP
CGC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057238
RefSeq Size 1200
RefSeq ORF 639
Locus ID 53916
UniProt ID P61018
Cytogenetics 19q13.2
Summary RAB proteins, such as RAB4B, are members of the RAS superfamily of small GTPases that are involved in vesicular trafficking (He et al., 2002 [PubMed 12450215]).[supplied by OMIM, Aug 2009]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RAB4B (NM_016154) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414149 RAB4B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414149 Transient overexpression lysate of RAB4B, member RAS oncogene family (RAB4B) 100 ug
$436.00
TP308302 Recombinant protein of human RAB4B, member RAS oncogene family (RAB4B), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.