RAB4B Rabbit Polyclonal Antibody
| Product Data | |
| Recommended Dilution | WB |
|---|---|
| Reactivity | Brugia malayi, Dog, Horse, Human, Mouse, Pig, Zebrafish |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-RAB4B antibody is: synthetic peptide directed towards the middle region of Human RAB4B. Synthetic peptide located within the following region: SPNIVVILCGNKKDLDPEREVTFLEASRFAQENELMFLETSALTGENVEE |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 23 kDa |
| Gene Name | RAB4B, member RAS oncogene family |
| Database Link | |
| Background | RAB proteins, such as RAB4B, are members of the RAS superfamily of small GTPases that are involved in vesicular trafficking. |
| Synonyms | FLJ78649; MGC52123 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Goat: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 86% |
| Reference Data | |
| Protein Families | Druggable Genome |
Write Your Own Review
| Product Manuals |
| FAQs |
| SDS |
Related Products
Check items to add to the cart or
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.