Nurim (NRM) (NM_007243) Human Mass Spec Standard

SKU
PH308090
NRM MS Standard C13 and N15-labeled recombinant protein (NP_009174)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208090]
Predicted MW 29.4 kDa
Protein Sequence
Protein Sequence
>RC208090 protein sequence
Red=Cloning site Green=Tags(s)

MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDRSILAPLAWDLGLL
LLFVGQHSLMAAERVKAWTSRYFGVLQRSLYVACTALALQLVMRYWEPIPKGPVLWEARAEPWATWVPLL
CFVLHVISWLLIFSILLVFDYAELMGLKQVYYHVLGLGEPLALKSPRALRLFSHLRHPVCVELLTVLWVV
PTLGTDRLLLAFLLTLYLGLAHGLDQQDLRYLRAQLQRKLHLLSRPQDGEAE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009174
RefSeq Size 1767
RefSeq ORF 786
Synonyms NRM29
Locus ID 11270
UniProt ID Q8IXM6
Cytogenetics 6p21.33
Summary The protein encoded by this gene contains transmembrane domains and resides within the inner nuclear membrane, where it is tightly associated with the nucleus. This protein shares homology with isoprenylcysteine carboxymethyltransferase enzymes. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Jul 2012]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:Nurim (NRM) (NM_007243) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416103 NRM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416103 Transient overexpression lysate of nurim (nuclear envelope membrane protein) (NRM) 100 ug
$436.00
TP308090 Recombinant protein of human nurim (nuclear envelope membrane protein) (NRM), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.