Nurim (NRM) Rabbit Polyclonal Antibody

SKU TA341888

Rabbit Polyclonal Anti-NRM Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NRM antibody: synthetic peptide directed towards the N terminal of human NRM. Synthetic peptide located within the following region: MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGW
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 29 kDa
• Gene Name: nurim (nuclear envelope membrane protein)
• Database Link:
  NP_009174
  Q8IXM6
• Background: The protein encoded byThis gene contains transmembrane domains and resides withinThe inner nuclear membrane, where it is tightly associated withThe nucleus.This protein shares homology with isoprenylcysteine carboxymethyltransferase enzymes. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Jul 2012]
• Synonyms: NRM29
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Dog: 86%; Bovine: 79%; Rabbit: 79%

Reference Data

• Protein Families: Transmembrane