Peroxiredoxin 6 (PRDX6) (NM_004905) Human Mass Spec Standard

SKU PH307780

PRDX6 MS Standard C13 and N15-labeled recombinant protein (NP_004896)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC207780]
• Predicted MW: 25 kDa
• Protein Sequence:
  Protein Sequence

  >RC207780 protein sequence; Red=Cloning site Green=Tags(s); ; MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIA; LSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPD; KKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKE; LPSGKKYLRYTPQP; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_004896
• RefSeq Size: 1715
• RefSeq ORF: 672
• Synonyms: 1-Cys; aiPLA2; AOP2; HEL-S-128m; LPCAT-5; NSGPx; p29; PRX
• Locus ID: 9588
• UniProt ID: P30041
• Cytogenetics: 1q25.1
• Summary: The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Methane metabolism, Phenylalanine metabolism