Peroxiredoxin 6 (PRDX6) (NM_004905) Human Tagged ORF Clone

SKU
RC207780
PRDX6 (Myc-DDK-tagged)-Human peroxiredoxin 6 (PRDX6)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Peroxiredoxin 6
Synonyms 1-Cys; aiPLA2; AOP2; HEL-S-128m; LPCAT-5; NSGPx; p29; PRX
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207780 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCGGAGGTCTGCTTCTCGGGGACGTGGCTCCCAACTTTGAGGCCAATACCACCGTCGGCCGCATCC
GTTTCCACGACTTTCTGGGAGACTCATGGGGCATTCTCTTCTCCCACCCTCGGGACTTTACCCCAGTGTG
CACCACAGAGCTTGGCAGAGCTGCAAAGCTGGCACCAGAATTTGCCAAGAGGAATGTTAAGTTGATTGCC
CTTTCAATAGACAGTGTTGAGGACCATCTTGCCTGGAGCAAGGATATCAATGCTTACAATTGTGAAGAGC
CCACAGAAAAGTTACCTTTTCCCATCATCGATGATAGGAATCGGGAGCTTGCCATCCTGTTGGGCATGCT
GGATCCAGCAGAGAAGGATGAAAAGGGCATGCCTGTGACAGCTCGTGTGGTGTTTGTTTTTGGTCCTGAT
AAGAAGCTGAAGCTGTCTATCCTCTACCCAGCTACCACTGGCAGGAACTTTGATGAGATTCTCAGGGTAG
TCATCTCTCTCCAGCTGACAGCAGAAAAAAGGGTTGCCACCCCAGTTGATTGGAAGGATGGGGATAGTGT
GATGGTCCTTCCAACCATCCCTGAAGAAGAAGCCAAAAAACTTTTCCCGAAAGGAGTCTTCACCAAAGAG
CTCCCATCTGGCAAGAAATACCTCCGCTACACACCCCAGCCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207780 protein sequence
Red=Cloning site Green=Tags(s)

MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIA
LSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPD
KKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKE
LPSGKKYLRYTPQP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004905
ORF Size 672 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004905.3
RefSeq Size 1715 bp
RefSeq ORF 675 bp
Locus ID 9588
UniProt ID P30041
Cytogenetics 1q25.1
Domains AhpC-TSA
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Methane metabolism, Phenylalanine metabolism
MW 25 kDa
Summary The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Peroxiredoxin 6 (PRDX6) (NM_004905) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207780L1 Lenti ORF clone of Human peroxiredoxin 6 (PRDX6), Myc-DDK-tagged 10 ug
$750.00
RC207780L2 Lenti ORF clone of Human peroxiredoxin 6 (PRDX6), mGFP tagged 10 ug
$750.00
RC207780L3 Lenti ORF clone of Human peroxiredoxin 6 (PRDX6), Myc-DDK-tagged 10 ug
$750.00
RC207780L4 Lenti ORF clone of Human peroxiredoxin 6 (PRDX6), mGFP tagged 10 ug
$750.00
RG207780 PRDX6 (tGFP-tagged) - Human peroxiredoxin 6 (PRDX6) 10 ug
$650.00
SC117092 PRDX6 (untagged)-Human peroxiredoxin 6 (PRDX6) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.