ETV7 (NM_016135) Human Mass Spec Standard

SKU
PH307742
ETV7 MS Standard C13 and N15-labeled recombinant protein (NP_057219)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207742]
Predicted MW 39 kDa
Protein Sequence
Protein Sequence
>RC207742 protein sequence
Red=Cloning site Green=Tags(s)

MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEY
SLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRALVCGPFFGGIFRLKTPTQHSP
VPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPA
MPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIKWEDKDAKIFRVVDPNGLARLWGNHKNRVNMTYEKMS
RALRHYYKLNIIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057219
RefSeq Size 1761
RefSeq ORF 1023
Synonyms TEL-2; TEL2; TELB
Locus ID 51513
UniProt ID Q9Y603
Cytogenetics 6p21.31
Summary The protein encoded by this gene belongs to the ETS family of transcription factors, which is a large group of evolutionarily conserved transcriptional regulators that play an important role in a variety of cellular processes throughout development and differentiation, and are involved in oncogenesis as well. This protein is predominantly expressed in hematopoietic tissues. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene (PMID:11108721).[provided by RefSeq, May 2011]
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Dorso-ventral axis formation
Write Your Own Review
You're reviewing:ETV7 (NM_016135) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414164 ETV7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414164 Transient overexpression lysate of ets variant 7 (ETV7) 100 ug
$436.00
TP307742 Recombinant protein of human ets variant 7 (ETV7), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.