FCER1G (NM_004106) Human Mass Spec Standard

SKU PH307585

FCER1G MS Standard C13 and N15-labeled recombinant protein (NP_004097)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC207585]
• Predicted MW: 9.8 kDa
• Protein Sequence:
  Protein Sequence

  >Peptide sequence encoded by RC207585; Blue=ORF Red=Cloning site Green=Tag(s); ; MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKVIQVRKAAITSYEKSDGVYTGL; STRNQETYETLKHEKPPQ; myc-FLAG tag; ; Recombinant protein using RC207585 also available, TP307585
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_004097
• RefSeq Size: 591
• RefSeq ORF: 261
• Synonyms: FCRG
• Locus ID: 2207
• UniProt ID: P30273
• Cytogenetics: 1q23.3
• Summary: The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane
• Protein Pathways: Asthma, Fc epsilon RI signaling pathway, Natural killer cell mediated cytotoxicity