GNMT (NM_018960) Human Mass Spec Standard

SKU
PH307497
GNMT MS Standard C13 and N15-labeled recombinant protein (NP_061833)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207497]
Predicted MW 32.7 kDa
Protein Sequence
Protein Sequence
>RC207497 protein sequence
Red=Cloning site Green=Tags(s)

MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGV
DSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLG
NSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVL
IVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQ
TYIPCYFIHVLKRTD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061833
RefSeq Size 1091
RefSeq ORF 885
Synonyms HEL-S-182mP
Locus ID 27232
UniProt ID Q14749
Cytogenetics 6p21.1
Summary The protein encoded by this gene is an enzyme that catalyzes the conversion of S-adenosyl-L-methionine (along with glycine) to S-adenosyl-L-homocysteine and sarcosine. This protein is found in the cytoplasm and acts as a homotetramer. Defects in this gene are a cause of GNMT deficiency (hypermethioninemia). Alternative splicing results in multiple transcript variants. Naturally occurring readthrough transcription occurs between the upstream CNPY3 (canopy FGF signaling regulator 3) gene and this gene and is represented with GeneID:107080644. [provided by RefSeq, Jan 2016]
Protein Families Druggable Genome
Protein Pathways Glycine, serine and threonine metabolism
Write Your Own Review
You're reviewing:GNMT (NM_018960) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412848 GNMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412848 Transient overexpression lysate of glycine N-methyltransferase (GNMT) 100 ug
$436.00
TP307497 Recombinant protein of human glycine N-methyltransferase (GNMT), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720534 Recombinant protein of human glycine N-methyltransferase (GNMT) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.