GNMT (NM_018960) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC207497] |
Predicted MW | 32.7 kDa |
Protein Sequence |
Protein Sequence
>RC207497 protein sequence
Red=Cloning site Green=Tags(s) MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGV DSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLG NSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVL IVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQ TYIPCYFIHVLKRTD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_061833 |
RefSeq Size | 1091 |
RefSeq ORF | 885 |
Synonyms | HEL-S-182mP |
Locus ID | 27232 |
UniProt ID | Q14749 |
Cytogenetics | 6p21.1 |
Summary | The protein encoded by this gene is an enzyme that catalyzes the conversion of S-adenosyl-L-methionine (along with glycine) to S-adenosyl-L-homocysteine and sarcosine. This protein is found in the cytoplasm and acts as a homotetramer. Defects in this gene are a cause of GNMT deficiency (hypermethioninemia). Alternative splicing results in multiple transcript variants. Naturally occurring readthrough transcription occurs between the upstream CNPY3 (canopy FGF signaling regulator 3) gene and this gene and is represented with GeneID:107080644. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Glycine, serine and threonine metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC412848 | GNMT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY412848 | Transient overexpression lysate of glycine N-methyltransferase (GNMT) | 100 ug |
$436.00
|
|
TP307497 | Recombinant protein of human glycine N-methyltransferase (GNMT), 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP720534 | Recombinant protein of human glycine N-methyltransferase (GNMT) | 10 ug |
$330.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.