F8A2 (NM_001007523) Human Mass Spec Standard

SKU
PH307473
F8A2 MS Standard C13 and N15-labeled recombinant protein (NP_001007524)
$3,255.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207473]
Predicted MW 39.1 kDa
Protein Sequence
Protein Sequence
>RC207473 protein sequence
Red=Cloning site Green=Tags(s)

MAAAAAGLGGGGAGPGPEAGDFLARYRLVSNKLKKRFLRKPNVAEAGEQFGQLGRELRAQECLPYAAWCQ
LAVARCQQALFHGPGEALALTEAARLFLRQERDARQRLVCPAAYGEPLQAAASALGAAVRLHLELGQPAA
AAALCLELAAALRDLGQPAAAAGHFQRAAQLQLPQLPLAALQALGEAASCQLLARDYTGALAVFTRMQRL
AREHGSHPVQSLPPPPPPAPQPGPGATPALPAALLPPNSGSAAPSPAALGAFSDVLVRCEVSRVLLLLLL
QPPPAKLLPEHAQTLEKYSWEAFDSHGQESSGQLPEELFLLLQSLVMATHEKDTEAIKSLQVEMWPLLTA
EQNHLLHLVLQETISPSGQGV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001007524
RefSeq Size 1116
RefSeq ORF 1113
Synonyms HAP40
Locus ID 474383
UniProt ID P23610
Cytogenetics Xq28
Summary This gene is part of a region that is repeated three times on chromosome X, once in intron 22 of the F8 gene and twice closer to the Xq telomere. This record represents the middle copy. Although its function is unknown, the observation that this gene is conserved in the mouse implies it has some function. Unlike factor VIII, this gene is transcribed abundantly in a wide variety of cell types. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:F8A2 (NM_001007523) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC423493 F8A2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY423493 Transient overexpression lysate of coagulation factor VIII-associated (intronic transcript) 2 (F8A2) 100 ug
$436.00
TP307473 Recombinant protein of human coagulation factor VIII-associated (intronic transcript) 2 (F8A2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.