CTRP4 (C1QTNF4) (NM_031909) Human Mass Spec Standard

SKU
PH307458
C1QTNF4 MS Standard C13 and N15-labeled recombinant protein (NP_114115)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207458]
Predicted MW 35.3 kDa
Protein Sequence
Protein Sequence
>RC207458 protein sequence
Red=Cloning site Green=Tags(s)

MLPLLLGLLGPAACWALGPTPGPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGDFDVATGQFRC
RVPGAYFFSFTAGKAPHKSLSVMLVRNRDEVQALAFDEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAP
QYALGAPGATFSGYLVYADADADAPARGPPAPPEPRSAFSAARTRSLVGSDAGPGPRHQPLAFDTEFVNI
GGDFDAAAGVFRCRLPGAYFFSFTLGKLPRKTLSVKLMKNRDEVQAMIYDDGASRRREMQSQSVMLALRR
GDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAPAAPPGLGASELL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_114115
RefSeq Size 1436
RefSeq ORF 987
Synonyms CTRP4; ZACRP4
Locus ID 114900
UniProt ID Q9BXJ3
Cytogenetics 11p11.2
Summary May be involved in the regulation of the inflammatory network. Its role as pro- or anti-inflammatory seems to be context dependent (PubMed:21658842, PubMed:27086950). Seems to have some role in regulating food intake and energy balance when administered in the brain. This effect is sustained over a two-day period, and it is accompanied by decreased expression of orexigenic neuropeptides in the hypothalamus 3 h post-injection (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:CTRP4 (C1QTNF4) (NM_031909) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410444 C1QTNF4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410444 Transient overexpression lysate of C1q and tumor necrosis factor related protein 4 (C1QTNF4) 100 ug
$436.00
TP307458 Recombinant protein of human C1q and tumor necrosis factor related protein 4 (C1QTNF4), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP701103 Purified recombinant protein of Human C1q and tumor necrosis factor related protein 4 (C1QTNF4), Leu17-End, with C-terminal His tag, secretory expressed in HEK293 cells, 50 ug 50 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.