CRY2 (NM_021117) Human Mass Spec Standard

SKU
PH307337
CRY2 MS Standard C13 and N15-labeled recombinant protein (NP_066940)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207337]
Predicted MW 66.9 kDa
Protein Sequence
Protein Sequence
>RC207337 protein sequence
Red=Cloning site Green=Tags(s)

MAATVATAAAVAPAPAPGTDSASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINR
WRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAG
VEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYG
VPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLS
CRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWA
EGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLS
CSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIV
NHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPK
RKLEAAEEPPGEELSKRARVAELPTPELPSKDA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_066940
RefSeq Size 4204
RefSeq ORF 1779
Synonyms HCRY2; PHLL2
Locus ID 1408
UniProt ID Q49AN0
Cytogenetics 11p11.2
Summary This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2014]
Protein Families Druggable Genome
Protein Pathways Circadian rhythm - mammal
Write Your Own Review
You're reviewing:CRY2 (NM_021117) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412078 CRY2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432326 CRY2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412078 Transient overexpression lysate of cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1 100 ug
$436.00
LY432326 Transient overexpression lysate of cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1 100 ug
$436.00
TP307337 Recombinant protein of human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.