YTHDF1 (NM_017798) Human Mass Spec Standard

SKU
PH307185
YTHDF1 MS Standard C13 and N15-labeled recombinant protein (NP_060268)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207185]
Predicted MW 60.9 kDa
Protein Sequence
Protein Sequence
>RC207185 protein sequence
Red=Cloning site Green=Tags(s)

MSATSVDTQRTKGQDNKVQNGSLHQKDTVHDNDFEPYLTGQSNQSNSYPSMSDPYLSSYYPPSIGFPYSL
NEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQ
QTQSSAYGSSYTYPPSSLGGTVVDGQPGFHSDTLSKAPGMNSLEQGMVGLKIGDVSSSAVKTVGSVVSSV
ALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPV
PKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNS
PGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKR
LDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLR
HIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060268
RefSeq Size 3277
RefSeq ORF 1677
Synonyms C20orf21
Locus ID 54915
UniProt ID Q9BYJ9
Cytogenetics 20q13.33
Summary Specifically recognizes and binds N6-methyladenosine (m6A)-containing mRNAs, and promotes mRNA translation efficiency (PubMed:24284625, PubMed:26046440, PubMed:26318451). M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing and stability (PubMed:24284625). Acts as a regulator of mRNA translation efficiency: promotes ribosome loading to m6A-containing mRNAs and interacts with translation initiation factors eIF3 (EIF3A or EIF3B) to facilitate translation initiation (PubMed:26046440). Required to facilitate learning and memory formation in the hippocampus by enhancing protein synthesis upon neuronal stimulation: in response to neuronal stimulation, binds to m6A-containing neuronal mRNAs, promoting their translation, thereby contributing to learning and memory (By similarity). Acts as a regulator of axon guidance by binding to m6A-containing ROBO3 transcripts, thereby promoting their translation (By similarity). Acts as a negative regulator of antigen cross-presentation in myeloid dendritic cells (By similarity). Acts by binding and promoting translation of m6A-containing transcripts encoding proteins involved in lysosomal degradation and phagosome maturation, leading to increased antigen degradation in myeloid dendritic cells (By similarity). In the context of tumorigenesis, negative regulation of antigen cross-presentation limits the anti-tumor response by reducing efficiency of tumor-antigen cross-presentation (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:YTHDF1 (NM_017798) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413537 YTHDF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413537 Transient overexpression lysate of YTH domain family, member 1 (YTHDF1) 100 ug
$436.00
TP307185 Recombinant protein of human YTH domain family, member 1 (YTHDF1), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.