BATF (NM_006399) Human Mass Spec Standard

SKU PH307104

BATF MS Standard C13 and N15-labeled recombinant protein (NP_006390)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC207104]
• Predicted MW: 14.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC207104 protein sequence; Red=Cloning site Green=Tags(s); ; MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRK; EIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_006390
• RefSeq Size: 953
• RefSeq ORF: 375
• Synonyms: B-ATF; BATF1; SFA-2; SFA2
• Locus ID: 10538
• UniProt ID: Q16520
• Cytogenetics: 14q24.3
• Summary: The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors