OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RBFOX2 (NM_001031695) Human Mass Spec Standard

Be the first to review this product
SKU
PH306846
RBM9 MS Standard C13 and N15-labeled recombinant protein (NP_001026865)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA345761 Rabbit Polyclonal Anti-RBM9 Antibody
100 ul
$585.00
LY415365 Transient overexpression lysate of RNA binding motif protein 9 (RBM9), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "RBFOX2 or NM_001031695"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206846
Predicted MW 40.4 kDa
Protein Sequence
Protein Sequence
>RC206846 protein sequence
Red=Cloning site Green=Tags(s)

MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGE
QSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDV
EIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVG
AVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGR
TVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTAD
PYHALAPAASYGVGAVASLYRGGYSRFAPY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001026865
RefSeq Size 6997
RefSeq ORF 1140
Synonyms dJ106I20.3; Fox-2; FOX2; fxh; HNRBP2; HRNBP2; RBM9; RTA
Locus ID 23543
UniProt ID O43251
Cytogenetics 22q12.3
Summary This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RBFOX2" proteins (9)
SKU Description Size Price
LC415365 Lyophilized RBFOX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421191 Lyophilized RBFOX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421192 Lyophilized RBFOX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421906 Lyophilized RBFOX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415365 Transient overexpression lysate of RNA binding motif protein 9 (RBM9), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY421191 Transient overexpression lysate of RNA binding motif protein 9 (RBM9), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY421192 Transient overexpression lysate of RNA binding motif protein 9 (RBM9), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY421906 Transient overexpression lysate of RNA binding motif protein 9 (RBM9), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP306846 Purified recombinant protein of Homo sapiens RNA binding motif protein 9 (RBM9), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products