TFE3 (NM_006521) Human Mass Spec Standard

SKU
PH306840
TFE3 MS Standard C13 and N15-labeled recombinant protein (NP_006512)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206840]
Predicted MW 61.5 kDa
Protein Sequence
Protein Sequence
>RC206840 protein sequence
Red=Cloning site Green=Tags(s)

MSHAAEPARDGVEASAEGPRAVFVLLEERRPADSAQLLSLNSLLPESGIVADIELENVLDPDSFYELKSQ
PLPLRSSLPISLQATPATPATLSASSSAGGSRTPAMSSSSSSRVLLRQQLMRAQAQEQERRERREQAAAA
PFPSPAPASPAISVVGVSAGGHTLSRPPPAQVPREVLKVQTHLENPTRYHLQQARRQQVKQYLSTTLGPK
LASQALTPPPGPASAQPLPAPEAAHTTGPTGSAPNSPMALLTIGSSSEKEIDDVIDEIISLESSYNDEML
SYLPGGTTGLQLPSTLPVSGNLLDVYSSQGVATPAITVSNSCPAELPNIKREISETEAKALLKERQKKDN
HNLIERRRRFNINDRIKELGTLIPKSSDPEMRWNKGTILKASVDYIRKLQKEQQRSKDLESRQRSLEQAN
RSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQ
QPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAASDPLLSSVSPAVS
KASSRRSSFSMEEES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006512
RefSeq Size 3467
RefSeq ORF 1725
Synonyms bHLHe33; RCCP2; RCCX1; TFEA
Locus ID 7030
UniProt ID P19532
Cytogenetics Xp11.23
Summary This gene encodes a basic helix-loop-helix domain-containing transcription factor that binds MUE3-type E-box sequences in the promoter of genes. The encoded protein promotes the expression of genes downstream of transforming growth factor beta (TGF-beta) signaling. This gene may be involved in chromosomal translocations in renal cell carcinomas and other cancers, resulting in the production of fusion proteins. Translocation partners include PRCC (papillary renal cell carcinoma), NONO (non-POU domain containing, octamer-binding), and ASPSCR1 (alveolar soft part sarcoma chromosome region, candidate 1), among other genes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:TFE3 (NM_006521) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416587 TFE3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416587 Transient overexpression lysate of transcription factor binding to IGHM enhancer 3 (TFE3) 100 ug
$436.00
TP306840 Recombinant protein of human transcription factor binding to IGHM enhancer 3 (TFE3), 20 µg 20 ug
$867.00
TP710034 Recombinant protein of human transcription factor binding to IGHM enhancer 3 (TFE3),with N-terminal polyhistidine tag, expressed in sf9 cells. 20 ug
$515.00
TP762495 Purified recombinant protein of Human transcription factor binding to IGHM enhancer 3 (TFE3), 322Cys-End, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$226.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.