CYTL1 (NM_018659) Human Mass Spec Standard

SKU PH306778

CYTL1 MS Standard C13 and N15-labeled recombinant protein (NP_061129)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC206778]
• Predicted MW: 15.6 kDa
• Protein Sequence:
  Protein Sequence

  >RC206778 protein sequence; Red=Cloning site Green=Tags(s); ; MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCV; LDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_061129
• RefSeq Size: 1019
• RefSeq ORF: 408
• Synonyms: C4orf4; C17
• Locus ID: 54360
• UniProt ID: Q9NRR1
• Cytogenetics: 4p16.2
• Summary: C17 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 (MIM 142230) surface marker (Liu et al., 2000 [PubMed 10857752]).[supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome, Secreted Protein