NPTX2 (NM_002523) Human Mass Spec Standard

SKU
PH306713
NPTX2 MS Standard C13 and N15-labeled recombinant protein (NP_002514)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206713]
Predicted MW 46.9 kDa
Protein Sequence
Protein Sequence
>RC206713 representing NM_002523
Red=Cloning site Green=Tags(s)

MLALLAASVALAVAAGAQDSPAPGSRFVCTALPPEAVHAGCPLPAMPMQGGAQSPEEELRAAVLQLRETV
VQQKETLGAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDPGHVVEQLSRSLQTLKDRLES
LEHQLRANVSNAGLPGDFREVLQQRLGELERQLLRKVAELEDEKSLLHNETSAHRQKTESTLNALLQRVT
ELERGNSAFKSPDAFKVSLPLRTNYLYGKIKKTLPELYAFTICLWLRSSASPGIGTPFSYAVPGQANEIV
LIEWGNNPIELLINDKVAQLPLFVSDGKWHHICVTWTTRDGMWEAFQDGEKLGTGENLAPWHPIKPGGVL
ILGQEQDTVGGRFDATQAFVGELSQFNIWDRVLRAQEIVNIANCSTNMPGNIIPWVDNNVDVFGGASKWP
VETCEERLLDL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002514
RefSeq Size 2746
RefSeq ORF 1293
Synonyms NARP; NP-II; NP2
Locus ID 4885
UniProt ID P47972
Cytogenetics 7q22.1
Summary This gene encodes a member of the family of neuronal petraxins, synaptic proteins that are related to C-reactive protein. This protein is involved in excitatory synapse formation. It also plays a role in clustering of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA)-type glutamate receptors at established synapses, resulting in non-apoptotic cell death of dopaminergic nerve cells. Up-regulation of this gene in Parkinson disease (PD) tissues suggests that the protein may be involved in the pathology of PD. [provided by RefSeq, Feb 2009]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:NPTX2 (NM_002523) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419275 NPTX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419275 Transient overexpression lysate of neuronal pentraxin II (NPTX2) 100 ug
$436.00
TP306713 Recombinant protein of human neuronal pentraxin II (NPTX2), 20 µg 20 ug
$737.00
TP701051 Purified recombinant protein of Human neuronal pentraxin II (NPTX2), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$867.00
TP710206 Purified recombinant protein of Human neuronal pentraxin II (NPTX2), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.