NONO (NM_007363) Human Mass Spec Standard

SKU
PH306688
NONO MS Standard C13 and N15-labeled recombinant protein (NP_031389)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206688]
Predicted MW 54.2 kDa
Protein Sequence
Protein Sequence
>RC206688 protein sequence
Red=Cloning site Green=Tags(s)

MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKTF
TQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLR
VRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSE
GSFLLTTFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQ
QQDQVDRNIKEAREKLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRR
REEEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMM
PDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_031389
RefSeq Size 3114
RefSeq ORF 1413
Synonyms MRXS34; NMT55; NRB54; P54; P54NRB; PPP1R114
Locus ID 4841
UniProt ID Q15233
Cytogenetics Xq13.1
Summary This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16. [provided by RefSeq, Feb 2009]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:NONO (NM_007363) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH326567 NONO MS Standard C13 and N15-labeled recombinant protein (NP_001138880) 10 ug
$3,255.00
PH326579 NONO MS Standard C13 and N15-labeled recombinant protein (NP_001138881) 10 ug
$3,255.00
LC402135 NONO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428867 NONO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428868 NONO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428869 NONO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402135 Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 2 100 ug
$436.00
LY428867 Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 1 100 ug
$436.00
LY428868 Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 3 100 ug
$436.00
LY428869 Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 4 100 ug
$436.00
TP306688 Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 2, 20 µg 20 ug
$867.00
TP326567 Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 1, 20 µg 20 ug
$867.00
TP326579 Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 3, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.