NONO (NM_001145409) Human Recombinant Protein
SKU
TP326579
Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 3, 20 µg
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC226579 protein sequence
Red=Cloning site Green=Tags(s) MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKTF TQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLR VRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSE GSFLLTTFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQ QQDQVDRNIKEAREKLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRR REEEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMM PDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001138881 |
Locus ID | 4841 |
UniProt ID | Q15233 |
Cytogenetics | Xq13.1 |
RefSeq Size | 3057 |
RefSeq ORF | 1413 |
Synonyms | MRXS34; NMT55; NRB54; P54; P54NRB; PPP1R114 |
Summary | This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16. [provided by RefSeq, Feb 2009] |
Protein Families | Druggable Genome, Transcription Factors |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH306688 | NONO MS Standard C13 and N15-labeled recombinant protein (NP_031389) | 10 ug |
$3,255.00
|
|
PH326567 | NONO MS Standard C13 and N15-labeled recombinant protein (NP_001138880) | 10 ug |
$3,255.00
|
|
PH326579 | NONO MS Standard C13 and N15-labeled recombinant protein (NP_001138881) | 10 ug |
$3,255.00
|
|
LC402135 | NONO HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428867 | NONO HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428868 | NONO HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428869 | NONO HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402135 | Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 2 | 100 ug |
$436.00
|
|
LY428867 | Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 1 | 100 ug |
$436.00
|
|
LY428868 | Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 3 | 100 ug |
$436.00
|
|
LY428869 | Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 4 | 100 ug |
$436.00
|
|
TP306688 | Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
TP326567 | Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.