NONO (NM_001145409) Human Recombinant Protein

SKU
TP326579
Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC226579 protein sequence
Red=Cloning site Green=Tags(s)

MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKTF
TQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLR
VRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSE
GSFLLTTFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQ
QQDQVDRNIKEAREKLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRR
REEEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMM
PDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001138881
Locus ID 4841
UniProt ID Q15233
Cytogenetics Xq13.1
RefSeq Size 3057
RefSeq ORF 1413
Synonyms MRXS34; NMT55; NRB54; P54; P54NRB; PPP1R114
Summary This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16. [provided by RefSeq, Feb 2009]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:NONO (NM_001145409) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306688 NONO MS Standard C13 and N15-labeled recombinant protein (NP_031389) 10 ug
$3,255.00
PH326567 NONO MS Standard C13 and N15-labeled recombinant protein (NP_001138880) 10 ug
$3,255.00
PH326579 NONO MS Standard C13 and N15-labeled recombinant protein (NP_001138881) 10 ug
$3,255.00
LC402135 NONO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428867 NONO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428868 NONO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428869 NONO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402135 Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 2 100 ug
$436.00
LY428867 Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 1 100 ug
$436.00
LY428868 Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 3 100 ug
$436.00
LY428869 Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 4 100 ug
$436.00
TP306688 Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 2, 20 µg 20 ug
$867.00
TP326567 Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.