OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ARSB (NM_198709) Human Mass Spec Standard

Be the first to review this product
SKU
PH306565
ARSB MS Standard C13 and N15-labeled recombinant protein (NP_942002)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA812951 ARSB mouse monoclonal antibody, clone OTI6G9 100 ul
$447.00
LY400011 Transient overexpression lysate of arylsulfatase B (ARSB), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "ARSB or NM_198709"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206565
Predicted MW 46 kDa
Protein Sequence
Protein Sequence
>RC206565 protein sequence
Red=Cloning site Green=Tags(s)

MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTP
HLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTT
HMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMY
STNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNV
TAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHI
SDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPYWPECSLLL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_942002
RefSeq Size 2172
RefSeq ORF 1239
Synonyms ASB; G4S; MPS6
Locus ID 411
UniProt ID P15848
Cytogenetics 5q14.1
Summary Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targeted to the lysozyme. Mucopolysaccharidosis type VI is an autosomal recessive lysosomal storage disorder resulting from a deficiency of arylsulfatase B. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. provided by RefSeq, Dec 2016
Protein Families Druggable Genome
Protein Pathways Glycosaminoglycan degradation, Lysosome, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ARSB" proteins (7)
SKU Description Size Price
PH314604 ARSB MS Standard C13 and N15-labeled recombinant protein (NP_000037) 10 ug
$3,360.00
LC400011 Lyophilized ARSB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404825 Lyophilized ARSB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400011 Transient overexpression lysate of arylsulfatase B (ARSB), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY404825 Transient overexpression lysate of arylsulfatase B (ARSB), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP306565 Recombinant protein of human arylsulfatase B (ARSB), transcript variant 2, 20 µg 20 ug
$867.00
TP314604 Recombinant protein of human arylsulfatase B (ARSB), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products