ARSB (NM_198709) Human Mass Spec Standard

SKU
PH306565
ARSB MS Standard C13 and N15-labeled recombinant protein (NP_942002)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206565]
Predicted MW 46 kDa
Protein Sequence
Protein Sequence
>RC206565 protein sequence
Red=Cloning site Green=Tags(s)

MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTP
HLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTT
HMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMY
STNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNV
TAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHI
SDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPYWPECSLLL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_942002
RefSeq Size 2172
RefSeq ORF 1239
Synonyms ASB; G4S; MPS6
Locus ID 411
UniProt ID P15848
Cytogenetics 5q14.1
Summary Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targeted to the lysozyme. Mucopolysaccharidosis type VI is an autosomal recessive lysosomal storage disorder resulting from a deficiency of arylsulfatase B. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Dec 2016]
Protein Families Druggable Genome
Protein Pathways Glycosaminoglycan degradation, Lysosome, Metabolic pathways
Write Your Own Review
You're reviewing:ARSB (NM_198709) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH314604 ARSB MS Standard C13 and N15-labeled recombinant protein (NP_000037) 10 ug
$3,255.00
LC400011 ARSB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404825 ARSB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400011 Transient overexpression lysate of arylsulfatase B (ARSB), transcript variant 1 100 ug
$665.00
LY404825 Transient overexpression lysate of arylsulfatase B (ARSB), transcript variant 2 100 ug
$436.00
TP306565 Recombinant protein of human arylsulfatase B (ARSB), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP314604 Recombinant protein of human arylsulfatase B (ARSB), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.