PADI4 (NM_012387) Human Mass Spec Standard

SKU
PH306501
PADI4 MS Standard C13 and N15-labeled recombinant protein (NP_036519)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206501]
Predicted MW 74.1 kDa
Protein Sequence
Protein Sequence
>RC206501 protein sequence
Red=Cloning site Green=Tags(s)

MAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHSPPAKKKSTGSSTWPL
DPGVEVTLTMKAASGSTGDQKVQISYYGPKTPPVKALLYLTAVEISLCADITRTGKVKPTRAVKDQRTWT
WGPCGQGAILLVNCDRDNLESSAMDCEDDEVLDSEDLQDMSLMTLSTKTPKDFFTNHTLVLHVARSEMDK
VRVFQATRGKLSSKCSVVLGPKWPSHYLMVPGGKHNMDFYVEALAFPDTDFPGLITLTISLLDTSNLELP
EAVVFQDSVVFRVAPWIMTPNTQPPQEVYACSIFENEDFLKSVTTLAMKAKCKLTICPEEENMDDQWMQD
EMEIGYIQAPHKTLPVVFDSPRNRGLKEFPIKRVMGPDFGYVTRGPQTGGISGLDSFGNLEVSPPVTVRG
KEYPLGRILFGDSCYPSNDSRQMHQALQDFLSAQQVQAPVKLYSDWLSVGHVDEFLSFVPAPDRKGFRLL
LASPRSCYKLFQEQQNEGHGEALLFEGIKKKKQQKIKNILSNKTLREHNSFVERCIDWNRELLKRELGLA
ESDIIDIPQLFKLKEFSKAEAFFPNMVNMLVLGKHLGIPKPFGPVINGRCCLEEKVCSLLEPLGLQCTFI
NDFFTYHIRHGEVHCGTNVRRKPFSFKWWNMVP

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036519
RefSeq Size 2265
RefSeq ORF 1989
Synonyms PAD; PAD4; PADI5; PDI4; PDI5
Locus ID 23569
UniProt ID Q9UM07
Cytogenetics 1p36.13
Summary This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:PADI4 (NM_012387) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402202 PADI4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402202 Transient overexpression lysate of peptidyl arginine deiminase, type IV (PADI4) 100 ug
$436.00
TP306501 Recombinant protein of human peptidyl arginine deiminase, type IV (PADI4), 20 µg 20 ug
$737.00
TP720870 Purified recombinant protein of Human peptidyl arginine deiminase, type IV (PADI4) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.