Occludin (OCLN) (NM_002538) Human Mass Spec Standard

SKU
PH306468
OCLN MS Standard C13 and N15-labeled recombinant protein (NP_002529)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206468]
Predicted MW 59.1 kDa
Protein Sequence
Protein Sequence
>RC206468 protein sequence
Red=Cloning site Green=Tags(s)

MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSM
LIIVMCIAIFACVASTLAWDRGYGTSLLGGSVGYPYGGSGFGSYGSGYGYGYGYGYGYGGYTDPRAAKGF
MLAMAAFCFIAALVIFVTSVIRSEMSRTRRYYLSVIIVSAILGIMVFIATIVYIMGVNPTAQSSGSLYGS
QIYALCNQFYTPAATGLYVDQYSYHYCVVDPQEAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNIL
WDKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEV
VQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREY
PPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGS
ADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002529
RefSeq Size 6451
RefSeq ORF 1566
Synonyms BLCPMG; PPP1R115; PTORCH1
Locus ID 100506658
UniProt ID Q16625
Cytogenetics 5q13.2
Summary This gene encodes an integral membrane protein that is required for cytokine-induced regulation of the tight junction paracellular permeability barrier. Mutations in this gene are thought to be a cause of band-like calcification with simplified gyration and polymicrogyria (BLC-PMG), an autosomal recessive neurologic disorder that is also known as pseudo-TORCH syndrome. Alternative splicing results in multiple transcript variants. A related pseudogene is present 1.5 Mb downstream on the q arm of chromosome 5. [provided by RefSeq, Apr 2011]
Write Your Own Review
You're reviewing:Occludin (OCLN) (NM_002538) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419249 OCLN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419249 Transient overexpression lysate of occludin (OCLN) 100 ug
$436.00
TP306468 Recombinant protein of human occludin (OCLN), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.