Myozenin 1 (MYOZ1) (NM_021245) Human Mass Spec Standard

SKU
PH306448
MYOZ1 MS Standard C13 and N15-labeled recombinant protein (NP_067068)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206448]
Predicted MW 31.7 kDa
Protein Sequence
Protein Sequence
>RC206448 protein sequence
Red=Cloning site Green=Tags(s)

MPLSGTPAPNKKRKSSKLIMELTGGGQESSGLNLGKKISVPRDVMLEELSLLTNRGSKMFKLRQMRVEKF
IYENHPDVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGGSGSAGQYGSDQQHHLGSGSG
AGGTGGPAGQAGRGGAAGTAGVGETGSGDQAGGEGKHITVFKTYISPWERAMGVDPQQKMELGIDLLAYG
AKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGE
PVDYNVDIGIPLDGETEEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_067068
RefSeq Size 1583
RefSeq ORF 897
Synonyms CS-2; FATZ; MYOZ
Locus ID 58529
UniProt ID Q9NP98
Cytogenetics 10q22.2
Summary The protein encoded by this gene is primarily expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling. [provided by RefSeq, Apr 2012]
Write Your Own Review
You're reviewing:Myozenin 1 (MYOZ1) (NM_021245) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411997 MYOZ1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411997 Transient overexpression lysate of myozenin 1 (MYOZ1) 100 ug
$436.00
TP306448 Recombinant protein of human myozenin 1 (MYOZ1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761507 Purified recombinant protein of Human myozenin 1 (MYOZ1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.