HAAO (NM_012205) Human Mass Spec Standard

SKU
PH306273
HAAO MS Standard C13 and N15-labeled recombinant protein (NP_036337)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206273]
Predicted MW 32.6 kDa
Protein Sequence
Protein Sequence
>RC206273 protein sequence
Red=Cloning site Green=Tags(s)

MERRLGVRAWVKENRGSFQPPVCNKLMHQEQLKVMFIGGPNTRKDYHIEEGEEVFYQLEGDMVLRVLEQG
KHRDVVIRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYVGDTMDVLFEKWFYCKDLGTQ
LAPIIQEFFSSEQYRTGKPIPDQLLKEPPFPLSTRSIMEPMSLDAWLDSHHRELQAGTPLSLFGDTYETQ
VIAYGQGSSEGLRQNVDVWLWQLEGSSVVTMGGRRLSLAPDDSLLVLAGTSYAWERTQGSVALSVTQDPA
CKKPLG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036337
RefSeq Size 1301
RefSeq ORF 858
Synonyms 3-HAO; h3HAO; HAO; VCRL1
Locus ID 23498
UniProt ID P46952
Cytogenetics 2p21
Summary 3-Hydroxyanthranilate 3,4-dioxygenase is a monomeric cytosolic protein belonging to the family of intramolecular dioxygenases containing nonheme ferrous iron. It is widely distributed in peripheral organs, such as liver and kidney, and is also present in low amounts in the central nervous system. HAAO catalyzes the synthesis of quinolinic acid (QUIN) from 3-hydroxyanthranilic acid. QUIN is an excitotoxin whose toxicity is mediated by its ability to activate glutamate N-methyl-D-aspartate receptors. Increased cerebral levels of QUIN may participate in the pathogenesis of neurologic and inflammatory disorders. HAAO has been suggested to play a role in disorders associated with altered tissue levels of QUIN. [provided by RefSeq, Jul 2008]
Protein Pathways Metabolic pathways, Tryptophan metabolism
Write Your Own Review
You're reviewing:HAAO (NM_012205) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415914 HAAO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415914 Transient overexpression lysate of 3-hydroxyanthranilate 3,4-dioxygenase (HAAO) 100 ug
$436.00
TP306273 Recombinant protein of human 3-hydroxyanthranilate 3,4-dioxygenase (HAAO), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.