HAAO (NM_012205) Human Tagged ORF Clone

SKU
RC206273
HAAO (Myc-DDK-tagged)-Human 3-hydroxyanthranilate 3,4-dioxygenase (HAAO)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HAAO
Synonyms 3-HAO; h3HAO; HAO; VCRL1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206273 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCGCCGCCTGGGAGTGAGGGCCTGGGTGAAGGAGAACCGGGGCTCCTTCCAGCCCCCGGTCTGCA
ACAAGCTCATGCACCAGGAGCAGCTCAAAGTCATGTTCATCGGAGGCCCCAACACCAGGAAGGACTATCA
CATCGAAGAGGGTGAAGAGGTATTTTACCAGCTGGAGGGAGACATGGTTCTCCGAGTCCTGGAGCAAGGG
AAACACCGGGATGTGGTCATTCGGCAGGGAGAGATATTCCTCCTGCCTGCCAGGGTGCCCCACTCACCAC
AGAGGTTTGCCAACACCGTGGGGCTGGTGGTTGAGCGAAGGCGGCTGGAGACCGAGCTAGATGGGCTCAG
GTACTATGTGGGCGACACCATGGACGTTCTGTTTGAGAAGTGGTTCTACTGCAAGGACCTCGGCACGCAG
TTGGCCCCCATCATCCAGGAGTTCTTCAGCTCTGAGCAGTACAGAACAGGAAAGCCCATCCCTGACCAGC
TGCTCAAGGAGCCACCATTCCCTCTAAGCACACGATCCATCATGGAGCCCATGTCCCTGGATGCCTGGCT
GGACAGCCACCACAGGGAGCTGCAGGCAGGCACACCACTCAGCCTGTTTGGGGACACCTATGAGACCCAG
GTGATCGCCTATGGGCAAGGCAGCAGCGAAGGCCTGAGACAGAATGTGGACGTGTGGCTGTGGCAGCTGG
AGGGCTCCTCGGTGGTGACAATGGGGGGACGGCGCCTGAGCCTGGCCCCTGATGACAGCCTCCTGGTGCT
AGCTGGGACCTCGTATGCCTGGGAGCGAACACAAGGCTCTGTGGCCCTGTCTGTGACCCAGGACCCTGCC
TGCAAGAAGCCCCTGGGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206273 protein sequence
Red=Cloning site Green=Tags(s)

MERRLGVRAWVKENRGSFQPPVCNKLMHQEQLKVMFIGGPNTRKDYHIEEGEEVFYQLEGDMVLRVLEQG
KHRDVVIRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYVGDTMDVLFEKWFYCKDLGTQ
LAPIIQEFFSSEQYRTGKPIPDQLLKEPPFPLSTRSIMEPMSLDAWLDSHHRELQAGTPLSLFGDTYETQ
VIAYGQGSSEGLRQNVDVWLWQLEGSSVVTMGGRRLSLAPDDSLLVLAGTSYAWERTQGSVALSVTQDPA
CKKPLG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_012205
ORF Size 858 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012205.3
RefSeq Size 1301 bp
RefSeq ORF 861 bp
Locus ID 23498
UniProt ID P46952
Cytogenetics 2p21
Protein Pathways Metabolic pathways, Tryptophan metabolism
MW 32.6 kDa
Summary 3-Hydroxyanthranilate 3,4-dioxygenase is a monomeric cytosolic protein belonging to the family of intramolecular dioxygenases containing nonheme ferrous iron. It is widely distributed in peripheral organs, such as liver and kidney, and is also present in low amounts in the central nervous system. HAAO catalyzes the synthesis of quinolinic acid (QUIN) from 3-hydroxyanthranilic acid. QUIN is an excitotoxin whose toxicity is mediated by its ability to activate glutamate N-methyl-D-aspartate receptors. Increased cerebral levels of QUIN may participate in the pathogenesis of neurologic and inflammatory disorders. HAAO has been suggested to play a role in disorders associated with altered tissue levels of QUIN. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:HAAO (NM_012205) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206273L1 Lenti ORF clone of Human 3-hydroxyanthranilate 3,4-dioxygenase (HAAO), Myc-DDK-tagged 10 ug
$600.00
RC206273L2 Lenti ORF clone of Human 3-hydroxyanthranilate 3,4-dioxygenase (HAAO), mGFP tagged 10 ug
$600.00
RC206273L3 Lenti ORF clone of Human 3-hydroxyanthranilate 3,4-dioxygenase (HAAO), Myc-DDK-tagged 10 ug
$600.00
RC206273L4 Lenti ORF clone of Human 3-hydroxyanthranilate 3,4-dioxygenase (HAAO), mGFP tagged 10 ug
$600.00
RG206273 HAAO (tGFP-tagged) - Human 3-hydroxyanthranilate 3,4-dioxygenase (HAAO) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC310572 HAAO (untagged)-Human 3-hydroxyanthranilate 3,4-dioxygenase (HAAO) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.