ECRG4 (NM_032411) Human Mass Spec Standard

SKU
PH306239
C2orf40 MS Standard C13 and N15-labeled recombinant protein (NP_115787)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206239]
Predicted MW 17.2 kDa
Protein Sequence
Protein Sequence
>RC206239 protein sequence
Red=Cloning site Green=Tags(s)

MAASPARPAVLALTGLALLLLLCWGPGGISGNKLKLMLQKREAPVPTKTKVAVDENKAKEFLGSLKRQKR
QLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPRSPYGFRHG
ASVNYDDY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115787
RefSeq Size 793
RefSeq ORF 444
Synonyms C2orf40
Locus ID 84417
UniProt ID Q9H1Z8
Cytogenetics 2q12.2
Summary Probable hormone that may attenuate cell proliferation and induce senescence of oligodendrocyte and neural precursor cells in the central nervous system (By similarity). ECRG4-induced senescence is characterized by G1 arrest, RB1 dephosphorylation and accelerated CCND1 and CCND3 proteasomal degradation (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Secreted Protein, Transmembrane
Write Your Own Review
You're reviewing:ECRG4 (NM_032411) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403168 C2orf40 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403168 Transient overexpression lysate of chromosome 2 open reading frame 40 (C2orf40) 100 ug
$436.00
TP306239 Recombinant protein of human chromosome 2 open reading frame 40 (C2orf40), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.