ECRG4 (NM_032411) Human Tagged ORF Clone

SKU
RC206239
C2orf40 (Myc-DDK-tagged)-Human chromosome 2 open reading frame 40 (C2orf40)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ECRG4
Synonyms C2orf40
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206239 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCCTCCCCCGCGCGGCCTGCTGTCCTGGCCCTGACCGGGCTGGCGCTGCTCCTGCTCCTGTGCT
GGGGCCCAGGTGGCATAAGTGGAAATAAACTCAAGCTGATGCTTCAAAAACGAGAAGCACCTGTTCCAAC
TAAGACTAAAGTGGCCGTTGATGAGAATAAAGCCAAAGAATTCCTTGGCAGCCTGAAGCGCCAGAAGCGG
CAGCTGTGGGACCGGACTCGGCCCGAGGTGCAGCAGTGGTACCAGCAGTTTCTCTACATGGGCTTTGACG
AAGCGAAATTTGAAGATGACATCACCTATTGGCTTAACAGAGATCGAAATGGACATGAATACTATGGCGA
TTACTACCAACGTCACTATGATGAAGACTCTGCAATTGGTCCCCGGAGCCCCTACGGCTTTAGGCATGGA
GCCAGCGTCAACTACGATGACTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206239 protein sequence
Red=Cloning site Green=Tags(s)

MAASPARPAVLALTGLALLLLLCWGPGGISGNKLKLMLQKREAPVPTKTKVAVDENKAKEFLGSLKRQKR
QLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPRSPYGFRHG
ASVNYDDY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_032411
ORF Size 444 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032411.3
RefSeq Size 793 bp
RefSeq ORF 447 bp
Locus ID 84417
UniProt ID Q9H1Z8
Cytogenetics 2q12.2
Protein Families Secreted Protein, Transmembrane
MW 17.2 kDa
Summary Probable hormone that may attenuate cell proliferation and induce senescence of oligodendrocyte and neural precursor cells in the central nervous system (By similarity). ECRG4-induced senescence is characterized by G1 arrest, RB1 dephosphorylation and accelerated CCND1 and CCND3 proteasomal degradation (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ECRG4 (NM_032411) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206239L1 Lenti ORF clone of Human chromosome 2 open reading frame 40 (C2orf40), Myc-DDK-tagged 10 ug
$450.00
RC206239L2 Lenti ORF clone of Human chromosome 2 open reading frame 40 (C2orf40), mGFP tagged 10 ug
$450.00
RC206239L3 Lenti ORF clone of Human chromosome 2 open reading frame 40 (C2orf40), Myc-DDK-tagged 10 ug
$450.00
RC206239L4 Lenti ORF clone of Human chromosome 2 open reading frame 40 (C2orf40), mGFP tagged 10 ug
$450.00
RG206239 C2orf40 (tGFP-tagged) - Human chromosome 2 open reading frame 40 (C2orf40) 10 ug
$489.00
SC104814 C2orf40 (untagged)-Human chromosome 2 open reading frame 40 (C2orf40) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.