EGLN2 (NM_053046) Human Mass Spec Standard

SKU
PH306152
EGLN2 MS Standard C13 and N15-labeled recombinant protein (NP_444274)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206152]
Predicted MW 43.7 kDa
Protein Sequence
Protein Sequence
>RC206152 protein sequence
Red=Cloning site Green=Tags(s)

MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATS
TTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRKWAEDGGDAPSPSKRPWARQE
NQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEV
EALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRT
KAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIF
WSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_444274
RefSeq Size 2264
RefSeq ORF 1221
Synonyms EIT-6; EIT6; HIF-PH1; HIFPH1; HPH-1; HPH-3; PHD1
Locus ID 112398
UniProt ID Q96KS0
Cytogenetics 19q13.2
Summary The hypoxia inducible factor (HIF) is a transcriptional complex that is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. This gene encodes an enzyme responsible for this post-translational modification. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream RAB4B (RAB4B, member RAS oncogene family) gene. [provided by RefSeq, Feb 2011]
Protein Families Druggable Genome
Protein Pathways Pathways in cancer, Renal cell carcinoma
Write Your Own Review
You're reviewing:EGLN2 (NM_053046) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403281 EGLN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409048 EGLN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403281 Transient overexpression lysate of egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 1 100 ug
$436.00
LY409048 Transient overexpression lysate of egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 3 100 ug
$436.00
TP306152 Recombinant protein of human egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 1, 20 µg 20 ug
$737.00
TP760370 Purified recombinant protein of Human egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 3, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.