EGLN2 (NM_053046) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC206152] |
Predicted MW | 43.7 kDa |
Protein Sequence |
Protein Sequence
>RC206152 protein sequence
Red=Cloning site Green=Tags(s) MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATS TTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRKWAEDGGDAPSPSKRPWARQE NQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEV EALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRT KAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIF WSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_444274 |
RefSeq Size | 2264 |
RefSeq ORF | 1221 |
Synonyms | EIT-6; EIT6; HIF-PH1; HIFPH1; HPH-1; HPH-3; PHD1 |
Locus ID | 112398 |
UniProt ID | Q96KS0 |
Cytogenetics | 19q13.2 |
Summary | The hypoxia inducible factor (HIF) is a transcriptional complex that is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. This gene encodes an enzyme responsible for this post-translational modification. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream RAB4B (RAB4B, member RAS oncogene family) gene. [provided by RefSeq, Feb 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Pathways in cancer, Renal cell carcinoma |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC403281 | EGLN2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC409048 | EGLN2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403281 | Transient overexpression lysate of egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 1 | 100 ug |
$436.00
|
|
LY409048 | Transient overexpression lysate of egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 3 | 100 ug |
$436.00
|
|
TP306152 | Recombinant protein of human egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP760370 | Purified recombinant protein of Human egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 3, with N-terminal HIS tag, expressed in E.Coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.