OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COX5A (NM_004255) Human Mass Spec Standard

Be the first to review this product
SKU
PH306046
COX5A MS Standard C13 and N15-labeled recombinant protein (NP_004246)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY418109 Transient overexpression lysate of cytochrome c oxidase subunit Va (COX5A), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00

Other products for "COX5A or NM_004255"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206046
Predicted MW 16.8 kDa
Protein Sequence
Protein Sequence
>RC206046 protein sequence
Red=Cloning site Green=Tags(s)

MLGAALRRCAVAATTRADPRGLLHSARTPGPAVAIQSVRCYSHGSQETDEEFDARWVTYFNKPDIDAWEL
RKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGIS
TPEELGLDKV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004246
RefSeq Size 784
RefSeq ORF 450
Synonyms COX; COX-VA; MC4DN20; VA
Locus ID 9377
UniProt ID P20674
Cytogenetics 15q24.2
Summary Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer of proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Va of the human mitochondrial respiratory chain enzyme. A pseudogene COX5AP1 has been found in chromosome 14q22. provided by RefSeq, Jul 2008
Protein Pathways Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "COX5A" proteins (3)
SKU Description Size Price
LC418109 Lyophilized COX5A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418109 Transient overexpression lysate of cytochrome c oxidase subunit Va (COX5A), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00
TP306046 Recombinant protein of human cytochrome c oxidase subunit Va (COX5A), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products