COX5A (NM_004255) Human Tagged ORF Clone

SKU
RC206046
COX5A (Myc-DDK-tagged)-Human cytochrome c oxidase subunit Va (COX5A), nuclear gene encoding mitochondrial protein
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol COX5A
Synonyms COX; COX-VA; MC4DN20; VA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206046 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGGCGCCGCTCTCCGCCGCTGCGCTGTGGCCGCAACCACCCGGGCCGACCCTCGAGGCCTCCTGC
ACTCCGCCCGGACCCCCGGCCCCGCCGTGGCTATCCAGTCAGTTCGCTGCTATTCCCATGGGTCACAGGA
GACAGATGAGGAGTTTGATGCTCGCTGGGTAACATACTTCAACAAGCCAGATATAGATGCCTGGGAATTG
CGTAAAGGGATAAACACACTTGTTACCTATGATATGGTTCCAGAGCCCAAAATCATTGATGCTGCTTTGC
GGGCATGCAGACGGTTAAATGATTTTGCTAGTACAGTTCGTATCCTAGAGGTTGTTAAGGACAAAGCAGG
ACCTCATAAGGAAATCTACCCCTATGTCATCCAGGAACTTAGACCAACTTTAAATGAACTGGGAATCTCC
ACTCCGGAGGAACTGGGCCTTGACAAAGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206046 protein sequence
Red=Cloning site Green=Tags(s)

MLGAALRRCAVAATTRADPRGLLHSARTPGPAVAIQSVRCYSHGSQETDEEFDARWVTYFNKPDIDAWEL
RKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGIS
TPEELGLDKV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004255
ORF Size 450 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004255.4
RefSeq Size 784 bp
RefSeq ORF 453 bp
Locus ID 9377
UniProt ID P20674
Cytogenetics 15q24.2
Domains COX5A
Protein Pathways Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
MW 16.8 kDa
Summary Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer of proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Va of the human mitochondrial respiratory chain enzyme. A pseudogene COX5AP1 has been found in chromosome 14q22. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:COX5A (NM_004255) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206046L3 Lenti ORF clone of Human cytochrome c oxidase subunit Va (COX5A), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$450.00
RC206046L4 Lenti ORF clone of Human cytochrome c oxidase subunit Va (COX5A), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$450.00
RG206046 COX5A (tGFP-tagged) - Human cytochrome c oxidase subunit Va (COX5A), nuclear gene encoding mitochondrial protein 10 ug
$489.00
SC117461 COX5A (untagged)-Human cytochrome c oxidase subunit Va (COX5A), nuclear gene encoding mitochondrial protein 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.