MTAP (NM_002451) Human Mass Spec Standard

SKU
PH306024
MTAP MS Standard C13 and N15-labeled recombinant protein (NP_002442)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206024]
Predicted MW 31.3 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC206024
Blue=ORF Red=Cloning site Green=Tag(s)

MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMP
SKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHI
PMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKE
AGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQF
SVFLPRH

myc-FLAG tag

Recombinant protein using RC206024 also available, TP306024
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002442
RefSeq Size 4937
RefSeq ORF 849
Synonyms BDMF; c86fus; DMSFH; DMSMFH; HEL-249; LGMBF; MSAP
Locus ID 4507
UniProt ID Q13126
Cytogenetics 9p21.3
Summary This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine. The encoded enzyme is deficient in many cancers because this gene and the tumor suppressor p16 gene are co-deleted. Multiple alternatively spliced transcript variants have been described for this gene, but their full-length natures remain unknown. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Cysteine and methionine metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:MTAP (NM_002451) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419313 MTAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419313 Transient overexpression lysate of methylthioadenosine phosphorylase (MTAP) 100 ug
$436.00
TP306024 Recombinant protein of human methylthioadenosine phosphorylase (MTAP), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.