Metallothionein (MT1A) (NM_005946) Human Mass Spec Standard

SKU PH305942

MT1A MS Standard C13 and N15-labeled recombinant protein (NP_005937)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC205942]
• Predicted MW: 6.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC205942 protein sequence; Red=Cloning site Green=Tags(s); ; MDPNCSCATGGSCTCTGSCKCKECKCNSCKKSCCSCCPMSCAKCAQGCICKGASEKCSCCA; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_005937
• RefSeq Size: 468
• RefSeq ORF: 183
• Synonyms: MT-1A; MT-IA; MT1; MT1S; MTC
• Locus ID: 4489
• UniProt ID: P04731
• Cytogenetics: 16q13
• Summary: This gene is a member of the metallothionein family of genes. Proteins encoded by this gene family are low in molecular weight, are cysteine-rich, lack aromatic residues, and bind divalent heavy metal ions. The conserved cysteine residues co-ordinate metal ions using mercaptide linkages. These proteins act as anti-oxidants, protect against hydroxyl free radicals, are important in homeostatic control of metal in the cell, and play a role in detoxification of heavy metals. Disruption of two metallothionein genes in mouse resulted in defects in protection against heavy metals, oxidative stress, immune reactions, carcinogens, and displayed obesity. [provided by RefSeq, Sep 2017]