Metallothionein (MT1A) (NM_005946) Human Tagged ORF Clone

SKU
RC205942
MT1A (Myc-DDK-tagged)-Human metallothionein 1A (MT1A)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Metallothionein
Synonyms MT-1A; MT-IA; MT1; MT1S; MTC
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205942 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCCCAACTGCTCCTGCGCCACTGGTGGCTCCTGCACCTGCACTGGCTCCTGCAAATGCAAAGAGT
GCAAATGCAACTCCTGCAAGAAGAGCTGCTGCTCCTGCTGCCCCATGAGCTGTGCCAAGTGTGCCCAGGG
CTGCATCTGCAAAGGGGCATCAGAGAAGTGCAGCTGCTGTGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205942 protein sequence
Red=Cloning site Green=Tags(s)

MDPNCSCATGGSCTCTGSCKCKECKCNSCKKSCCSCCPMSCAKCAQGCICKGASEKCSCCA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005946
ORF Size 183 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005946.1
RefSeq Size 468 bp
RefSeq ORF 186 bp
Locus ID 4489
UniProt ID P04731
Cytogenetics 16q13
MW 6.1 kDa
Summary This gene is a member of the metallothionein family of genes. Proteins encoded by this gene family are low in molecular weight, are cysteine-rich, lack aromatic residues, and bind divalent heavy metal ions. The conserved cysteine residues co-ordinate metal ions using mercaptide linkages. These proteins act as anti-oxidants, protect against hydroxyl free radicals, are important in homeostatic control of metal in the cell, and play a role in detoxification of heavy metals. Disruption of two metallothionein genes in mouse resulted in defects in protection against heavy metals, oxidative stress, immune reactions, carcinogens, and displayed obesity. [provided by RefSeq, Sep 2017]
Write Your Own Review
You're reviewing:Metallothionein (MT1A) (NM_005946) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205942L1 Lenti ORF clone of Human metallothionein 1A (MT1A), Myc-DDK-tagged 10 ug
$450.00
RC205942L2 Lenti ORF clone of Human metallothionein 1A (MT1A), mGFP tagged 10 ug
$450.00
RC205942L3 Lenti ORF clone of Human metallothionein 1A (MT1A), Myc-DDK-tagged 10 ug
$450.00
RC205942L4 Lenti ORF clone of Human metallothionein 1A (MT1A), mGFP tagged 10 ug
$450.00
RG205942 MT1A (tGFP-tagged) - Human metallothionein 1A (MT1A) 10 ug
$489.00
SC122731 MT1A (untagged)-Human metallothionein 1A (MT1A) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.