HSD17B11 (NM_016245) Human Mass Spec Standard

SKU
PH305941
HSD17B11 MS Standard C13 and N15-labeled recombinant protein (NP_057329)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205941]
Predicted MW 32.8 kDa
Protein Sequence
Protein Sequence
>RC205941 representing NM_016245
Red=Cloning site Green=Tags(s)

MKFLLDILLLLPLLIVCSLESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINK
HGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKT
FEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITG
VKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAV
LKRKISVKFDAVIGYKMKAQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057329
RefSeq Size 1701
RefSeq ORF 900
Synonyms 17-BETA-HSD11; 17-BETA-HSDXI; 17BHSD11; DHRS8; PAN1B; RETSDR2; SDR16C2
Locus ID 51170
UniProt ID Q8NBQ5
Cytogenetics 4q22.1
Summary Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones (Brereton et al., 2001 [PubMed 11165019]).[supplied by OMIM, Jun 2009]
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:HSD17B11 (NM_016245) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414088 HSD17B11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414088 Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 11 (HSD17B11) 100 ug
$436.00
TP305941 Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 11 (HSD17B11), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.