HSD17B11 (NM_016245) Human Recombinant Protein

SKU
TP305941
Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 11 (HSD17B11), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205941 representing NM_016245
Red=Cloning site Green=Tags(s)

MKFLLDILLLLPLLIVCSLESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINK
HGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKT
FEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITG
VKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAV
LKRKISVKFDAVIGYKMKAQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_057329
Locus ID 51170
UniProt ID Q8NBQ5
Cytogenetics 4q22.1
RefSeq Size 1701
RefSeq ORF 900
Synonyms 17-BETA-HSD11; 17-BETA-HSDXI; 17BHSD11; DHRS8; PAN1B; RETSDR2; SDR16C2
Summary Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones (Brereton et al., 2001 [PubMed 11165019]).[supplied by OMIM, Jun 2009]
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:HSD17B11 (NM_016245) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305941 HSD17B11 MS Standard C13 and N15-labeled recombinant protein (NP_057329) 10 ug
$3,255.00
LC414088 HSD17B11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414088 Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 11 (HSD17B11) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.