Myosin Light Chain 2 (MYL2) (NM_000432) Human Mass Spec Standard

SKU PH305932

MYL2 MS Standard C13 and N15-labeled recombinant protein (NP_000423)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC205932]
• Predicted MW: 18.8 kDa
• Protein Sequence:
  Protein Sequence

  >RC205932 protein sequence; Red=Cloning site Green=Tags(s); ; MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMI; KEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFA; AFPPDVTGNLDYKNLVHIITHGEEKD; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_000423
• RefSeq Size: 855
• RefSeq ORF: 498
• Synonyms: CMH10; MLC-2s/v; MLC2
• Locus ID: 4633
• UniProt ID: P10916
• Cytogenetics: 12q24.11
• Summary: Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008]
• Protein Pathways: Cardiac muscle contraction, Dilated cardiomyopathy, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction