IFI30 (NM_006332) Human Mass Spec Standard

SKU
PH305877
IFI30 MS Standard C13 and N15-labeled recombinant protein (NP_006323)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205877]
Predicted MW 28 kDa
Protein Sequence
Protein Sequence
>RC205877 protein sequence
Red=Cloning site Green=Tags(s)

MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEA
LCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDME
LAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTV
NGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006323
RefSeq Size 1034
RefSeq ORF 750
Synonyms GILT; IFI-30; IP-30; IP30
Locus ID 10437
UniProt ID P13284
Cytogenetics 19p13.11
Summary The protein encoded by this gene is a lysosomal thiol reductase that at low pH can reduce protein disulfide bonds. The enzyme is expressed constitutively in antigen-presenting cells and induced by gamma-interferon in other cell types. This enzyme has an important role in MHC class II-restricted antigen processing. [provided by RefSeq, Jul 2008]
Protein Pathways Antigen processing and presentation
Write Your Own Review
You're reviewing:IFI30 (NM_006332) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416719 IFI30 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416719 Transient overexpression lysate of interferon, gamma-inducible protein 30 (IFI30) 100 ug
$436.00
TP305877 Purified recombinant protein of Homo sapiens interferon, gamma-inducible protein 30 (IFI30), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.