PCID1 (EIF3M) (NM_006360) Human Mass Spec Standard

SKU
PH305694
EIF3M MS Standard C13 and N15-labeled recombinant protein (NP_006351)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205694]
Predicted MW 42.5 kDa
Protein Sequence
Protein Sequence
>RC205694 protein sequence
Red=Cloning site Green=Tags(s)

MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSL
LLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYI
PTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVR
ALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLL
TFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQL
YDTLNAWKQNLNKVKNSLLSLSDT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006351
RefSeq Size 1338
RefSeq ORF 1122
Synonyms B5; GA17; hfl-B5; PCID1; TANGO7
Locus ID 10480
UniProt ID Q7L2H7
Cytogenetics 11p13
Summary This gene encodes a protein that is part of the eurkaryotic translation initiation factor 3 complete (eIF-3) required for protein synthesis. Elevated levels of the encoded protein are present in cancer cell lines. Inactivation of the encoded protein has been shown to interfere with translation of herpes virus mRNAs by preventing the association of mRNAs with the ribosomes. A pseudogene of this gene is located on the X chromosome. [provided by RefSeq, Dec 2011]
Write Your Own Review
You're reviewing:PCID1 (EIF3M) (NM_006360) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416700 EIF3M HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416700 Transient overexpression lysate of eukaryotic translation initiation factor 3, subunit M (EIF3M) 100 ug
$436.00
TP305694 Recombinant protein of human eukaryotic translation initiation factor 3, subunit M (EIF3M), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.