SPR (NM_003124) Human Mass Spec Standard

SKU
PH305679
SPR MS Standard C13 and N15-labeled recombinant protein (NP_003115)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205679]
Predicted MW 28 kDa
Protein Sequence
Protein Sequence
>RC205679 protein sequence
Red=Cloning site Green=Tags(s)

MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADL
GAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLK
AFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLAR
ETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003115
RefSeq Size 1466
RefSeq ORF 783
Synonyms SDR38C1
Locus ID 6697
UniProt ID P35270
Cytogenetics 2p13.2
Summary This gene encodes an aldo-keto reductase that catalyzes the NADPH-dependent reduction of pteridine derivatives and is important in the biosynthesis of tetrahydrobiopterin (BH4). Mutations in this gene result in DOPA-responsive dystonia due to sepiaterin reductase deficiency. A pseudogene has been identified on chromosome 1. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Folate biosynthesis, Metabolic pathways
Write Your Own Review
You're reviewing:SPR (NM_003124) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401086 SPR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401086 Transient overexpression lysate of sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) (SPR) 100 ug
$436.00
TP305679 Recombinant protein of human sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) (SPR), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.