SPR (NM_003124) Human Tagged ORF Clone

SKU
RC205679
SPR (Myc-DDK-tagged)-Human sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) (SPR)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SPR
Synonyms SDR38C1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205679 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGGCGGGCTGGGGCGTGCTGTGTGCTTGCTGACCGGGGCCTCCCGCGGCTTCGGCCGGACGCTGG
CCCCGCTCCTGGCCTCGCTGCTGTCGCCCGGCTCCGTGCTTGTCCTTAGCGCCCGCAACGACGAGGCACT
GCGCCAGCTGGAGGCCGAGCTGGGCGCCGAGCGGTCTGGCCTGCGCGTGGTGCGGGTGCCCGCCGACCTG
GGCGCCGAGGCCGGCTTGCAGCAGCTGCTCGGCGCCCTGCGCGAGCTCCCCCGGCCCAAGGGGCTGCAGC
GACTGCTGCTTATCAACAACGCGGGCTCTCTTGGGGATGTGTCCAAAGGCTTCGTGGACCTGAGTGACTC
CACTCAAGTGAACAACTACTGGGCACTGAACTTGACCTCCATGCTCTGCCTGACTTCCAGCGTCCTGAAG
GCCTTCCCGGACAGTCCTGGCCTCAACAGAACCGTGGTTAACATCTCGTCCCTCTGTGCCCTGCAACCTT
TCAAAGGCTGGGCGCTGTACTGTGCAGGAAAGGCTGCTCGTGATATGCTGTTCCAGGTCCTGGCGCTGGA
GGAACCTAATGTGAGGGTGCTGAACTATGCCCCAGGTCCTCTGGACACAGACATGCAGCAGTTGGCCCGG
GAGACCTCCGTGGACCCAGACATGCGAAAAGGGCTGCAGGAGCTGAAGGCAAAGGGGAAGCTGGTGGATT
GCAAGGTGTCAGCCCAGAAACTGCTGAGCTTACTGGAAAAGGACGAGTTCAAGTCTGGAGCCCACGTGGA
CTTCTATGACAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205679 protein sequence
Red=Cloning site Green=Tags(s)

MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADL
GAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLK
AFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLAR
ETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003124
ORF Size 783 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003124.5
RefSeq Size 1466 bp
RefSeq ORF 786 bp
Locus ID 6697
UniProt ID P35270
Cytogenetics 2p13.2
Domains adh_short
Protein Families Druggable Genome
Protein Pathways Folate biosynthesis, Metabolic pathways
MW 28 kDa
Summary This gene encodes an aldo-keto reductase that catalyzes the NADPH-dependent reduction of pteridine derivatives and is important in the biosynthesis of tetrahydrobiopterin (BH4). Mutations in this gene result in DOPA-responsive dystonia due to sepiaterin reductase deficiency. A pseudogene has been identified on chromosome 1. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:SPR (NM_003124) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205679L1 Lenti ORF clone of Human sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) (SPR), Myc-DDK-tagged 10 ug
$600.00
RC205679L2 Lenti ORF clone of Human sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) (SPR), mGFP tagged 10 ug
$600.00
RC205679L3 Lenti ORF clone of Human sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) (SPR), Myc-DDK-tagged 10 ug
$600.00
RC205679L4 Lenti ORF clone of Human sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) (SPR), mGFP tagged 10 ug
$600.00
RG205679 SPR (tGFP-tagged) - Human sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) (SPR) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC118171 SPR (untagged)-Human sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) (SPR) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.