AKAP associated Sperm Protein (ROPN1L) (NM_031916) Human Mass Spec Standard

SKU
PH305543
ROPN1L MS Standard C13 and N15-labeled recombinant protein (NP_114122)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205543]
Predicted MW 26.2 kDa
Protein Sequence
Protein Sequence
>RC205543 protein sequence
Red=Cloning site Green=Tags(s)

MPLPDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADVLRWSAGYFSALSRGDPLPVKDRMEMPTATQKT
DTGLTQGLLKVLHKQCHHKRYVELTDLEQKWKNLCLPKEKFKALLQLDPCENKIKWINFLALGCSMLGGS
LNTALKHLCEILTDDREGGPARIPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSD
FFFPKRKLLESIENSEDVGH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_114122
RefSeq Size 1093
RefSeq ORF 690
Synonyms ASP; RSPH11
Locus ID 83853
UniProt ID Q96C74
Cytogenetics 5p15.2
Summary This gene encodes a member of the ropporin family. The encoded protein is present in sperm and interacts with A-kinase anchoring protein, AKAP3, through the amphipathic helix region of AKAP3. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2014]
Write Your Own Review
You're reviewing:AKAP associated Sperm Protein (ROPN1L) (NM_031916) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410431 ROPN1L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410431 Transient overexpression lysate of ropporin 1-like (ROPN1L) 100 ug
$436.00
TP305543 Recombinant protein of human ropporin 1-like (ROPN1L), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.