AKAP associated Sperm Protein (ROPN1L) Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ROPN1L antibody: synthetic peptide directed towards the C terminal of human ROPN1L. Synthetic peptide located within the following region: DVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENSEDVGH |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 26 kDa |
| Gene Name | rhophilin associated tail protein 1 like |
| Database Link | |
| Background | This gene encodes a member of the ropporin family. The encoded protein is a sperm protein. It interacts with A-kinase anchoring protein, AKAP3, through the amphipathic helix region of AKAP3. Type II regulatory subunit of cAMP-dependent protein kinase (PKARII) also binds to this helix domain of AKAP3, which allows PKARII to be targeted to specific subcellular compartments. It is suggested that sperm contains several proteins that bind to AKAPs in a manner similar to PKARII, and this encoded protein may be one of them. |
| Synonyms | ASP; RSPH11 |
| Note | Immunogen Sequence Homology: Human: 100% |
| Reference Data | |
| Protein Categories | Intracellular Proteins |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
AKAP1 Deficiency Attenuates Diet-Induced Obesity and Insulin Resistance by Promoting Fatty Acid Oxidation and Thermogenesis in Brown Adipocytes
Ji, Zhao, He et al
Adv Sci (Weinh) (2021) 8 (6), 2002794 DOI: 10.1002/advs.202002794
Ji, Zhao, He et al
Adv Sci (Weinh) (2021) 8 (6), 2002794 DOI: 10.1002/advs.202002794
Cited by 29
AI Summary: In this paper, OriGene’s AKAP1 cDNA (Cat# MR206481) and AKAP1 shRNA plasmids (Cat# TG501060, TG501061, TG501062, TG501063) were used to manipulate AKAP1 expression in brown adipocytes, enabling the authors to investigate the role of AKAP1 in regulating obesity, insulin resistance, and thermogenesis.
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
