AKAP associated Sperm Protein (ROPN1L) Rabbit Polyclonal Antibody

SKU TA342988

Rabbit Polyclonal Anti-ROPN1L Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ROPN1L antibody: synthetic peptide directed towards the C terminal of human ROPN1L. Synthetic peptide located within the following region: DVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENSEDVGH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 26 kDa
• Gene Name: rhophilin associated tail protein 1 like
• Database Link:
  NP_114122
  Q96C74
• Background: This gene encodes a member of the ropporin family. The encoded protein is a sperm protein. It interacts with A-kinase anchoring protein, AKAP3, through the amphipathic helix region of AKAP3. Type II regulatory subunit of cAMP-dependent protein kinase (PKARII) also binds to this helix domain of AKAP3, which allows PKARII to be targeted to specific subcellular compartments. It is suggested that sperm contains several proteins that bind to AKAPs in a manner similar to PKARII, and this encoded protein may be one of them.
• Synonyms: ASP; RSPH11
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data