RAB18 (NM_021252) Human Mass Spec Standard

SKU
PH305505
RAB18 MS Standard C13 and N15-labeled recombinant protein (NP_067075)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205505]
Predicted MW 23 kDa
Protein Sequence
Protein Sequence
>RC205505 protein sequence
Red=Cloning site Green=Tags(s)

MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERF
RTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFA
RKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_067075
RefSeq Size 5003
RefSeq ORF 618
Synonyms RAB18LI1; WARBM3
Locus ID 22931
UniProt ID Q9NP72
Cytogenetics 10p12.1
Summary The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies is zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RAB18 (NM_021252) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402861 RAB18 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402861 Transient overexpression lysate of RAB18, member RAS oncogene family (RAB18) 100 ug
$436.00
TP305505 Recombinant protein of human RAB18, member RAS oncogene family (RAB18), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.